PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG215900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 730aa    MW: 82522.9 Da    PI: 6.1891
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG215900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.39e-1023527221374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+avs ++ +la+ +L+ +++++s +gd ++Rla++++  L+arl +++s+ly++l ++  +       l++++l   + P+
  Pavir.9NG215900.1.p 352 LRTLLIHCAQAVSVSNYTLASDILSIIRKNCSISGDDTERLASCLVDCLEARLDGTGSQLYQKLITKFRN---AMGFLKVFQLSLAINPF 438
                          6789*********************************************************999888877...89999************ PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                             ++   N++Ile ++g+ +vHiiDf+i  G+QWp+L+++La+R++gpp++RiTg+++p++g    ++ ++tg+ La++A+ ++vpfe+
  Pavir.9NG215900.1.p 439 QMATYHFSNKTILEVTKGKPKVHIIDFGIFLGFQWPSLFEQLAKREDGPPKVRITGIEKPQPGfrPDQMNKNTGHLLAEYASMFNVPFEY 528
                          ****************************************************************9999999******************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +v +++++e++++e+++++++++l+Vn+ +++++l de+vs++s+r++vL++++ ++Pkv+v+   + +++++ Fl+rf e +++ysalf
  Pavir.9NG215900.1.p 529 QV-ISSKWETIHVEDFHIEEDDVLIVNCLYRMEQLGDETVSINSARNKVLSTIRMTKPKVFVHGVVNGSYSAPFFLTRFKEVMYHYSALF 617
                          *9.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d l++++pr++e+r+ +Er +   +i nv+aceg++r+er e+++kW++r  +aG++++pl+ +++k  + ++ ++++d y v e++++l
  Pavir.9NG215900.1.p 618 DILDKTVPRDNEARMILERDVYLCSILNVIACEGSDRIERPESYKKWKSRNLKAGLEQLPLNPDIVKVTRDVVGQYHKD-YVVGEDDQWL 706
                          *****************************************************************************77.********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +lgWk+r L ++S W+
  Pavir.9NG215900.1.p 707 LLGWKGRILKAISTWK 722
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.304326703IPR005202Transcription factor GRAS
PfamPF035143.1E-99352722IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MEFNDKSNTN FDDFSSSLLS TSGSYAPSQK FVDPANESND LELFLHPPNS TNYYPPVSST  60
SNDEGHFTSN TSYSSSSKTY APQFCEVSSN VTPDWYGISV ADSSRSSWVN SDITINYINK  120
LLMQEDNDDK VKLHHGEYAL RAMEEPFYKL LGQSRPAYPL LPLCSSDHLN NLDGCMNKSS  180
GQSSSSCSAY MDPTNNHSND NLQAVEAPWS LSDIVKETKH FAQGTHSMER GLDVDGLSVA  240
EERSREKPVN VADKRMDVSS EVQCQNDPHT EDFCLLEGRS TKQLAISFNG PTRDEMFDRV  300
LLFSEHKPMD EGIVLGEKRT NKSAHQNDQG RASSARRRTK GKKQQKKEVV DLRTLLIHCA  360
QAVSVSNYTL ASDILSIIRK NCSISGDDTE RLASCLVDCL EARLDGTGSQ LYQKLITKFR  420
NAMGFLKVFQ LSLAINPFQM ATYHFSNKTI LEVTKGKPKV HIIDFGIFLG FQWPSLFEQL  480
AKREDGPPKV RITGIEKPQP GFRPDQMNKN TGHLLAEYAS MFNVPFEYQV ISSKWETIHV  540
EDFHIEEDDV LIVNCLYRME QLGDETVSIN SARNKVLSTI RMTKPKVFVH GVVNGSYSAP  600
FFLTRFKEVM YHYSALFDIL DKTVPRDNEA RMILERDVYL CSILNVIACE GSDRIERPES  660
YKKWKSRNLK AGLEQLPLNP DIVKVTRDVV GQYHKDYVVG EDDQWLLLGW KGRILKAIST  720
WKPNESYET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-383567228375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008665058.10.0PREDICTED: scarecrow-like protein 34 isoform X2
TrEMBLK4AMS50.0K4AMS5_SETIT; Uncharacterized protein
STRINGSi040221m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein